| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4142 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 895.1642 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 895.1643 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4139 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 607.0513 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4109 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.416 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2661 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1115.2575 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 891.4213 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2684 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4114 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 651.8402 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2665 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2673 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2677 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 891.4232 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 884.1379 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4146 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2651 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2647 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4108 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.266 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 651.8416 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 651.839 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 884.1387 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 884.1377 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 626.7813 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 607.0527 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 668.3187 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 891.4197 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 651.8398 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4123 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 895.1629 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 651.8406 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4131 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.415 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 895.1663 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.2643 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.41504 | 5 | 1 | 24601666 | | Mascot_Score | 62.05 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.41455 | 5 | 1 | 24601666 | | Mascot_Score | 35.98 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.41602 | 5 | 1 | 24601666 | | Mascot_Score | 47.94 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.26648 | 4 | 1 | 24601666 | | Mascot_Score | 41.23 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.26843 | 4 | 1 | 24601666 | | Mascot_Score | 48.89 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.26733 | 4 | 1 | 24601666 | | Mascot_Score | 47.22 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.4118 | 5 | 1 | 24601666 | | Mascot_Score | 66.45 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 1110.26465 | 4 | 1 | 24601666 | | Mascot_Score | 45.13 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR | 888.41595 | 5 | 1 | 24601666 | | Mascot_Score | 41.62 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |