| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 752.6346 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 668.3176 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 746.8603 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1234 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1245 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 728.3128 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 745.7416 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 745.7418 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 953.9596 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 998.9383 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1077.1581 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.92078 | 4 | 1 | 17317660 | -1.22192 | PTM_Score | | | plasma membrane | col-0 | continuous light | in-solution | TiO2 | trypsin | | LTQ-FT | cell culture | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1248 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1263 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1242.2301 | 3 | 1 | 24601666 | | Mascot_Score | 30.66 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 668.3171 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1256 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 888.4122 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1242.22778 | 3 | 1 | 24601666 | | Mascot_Score | 50.82 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1261 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.92395 | 4 | 1 | 24601666 | | Mascot_Score | 18.49 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1242.22852 | 3 | 1 | 24601666 | | Mascot_Score | 48.24 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1242 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1257 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 908.7603 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 960.9558 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1077.1527 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 745.74036 | 5 | 1 | 24601666 | | Mascot_Score | 39.28 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 744.632 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1253 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 913.0536 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 953.9584 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 552.5885 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.125 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 745.7398 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.9239 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1075.1467 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1242.2301 | 3 | 1 | 24601666 | | Mascot_Score | 39.66 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.92389 | 4 | 1 | 24601666 | | Mascot_Score | 58.23 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 953.9594 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 998.942 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 908.7593 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1242.2278 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.92078 | 4 | 1 | 17317660 | -1.22192 | XCorr | 0 | | plasma membrane | col-0 | continuous light | in-solution | TiO2 | trypsin | | LTQ-FT | cell culture | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 668.3167 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 955.3842 | 2 | 1 | 23328941 | | Mascot_Score | 30 | 4 days | total protein | col-0 | 16h light/8h dark | in-solution | Ti4+ | trypsin | | LTQ-Orbitrap | root | auxin |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 888.4108 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.127 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 745.73981 | 5 | 1 | 24601666 | | Mascot_Score | 45.24 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1255 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1215.871 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 728.3118 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.9213 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 888.4147 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 953.9592 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.92248 | 4 | 1 | 24601666 | | Mascot_Score | 47.16 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.92334 | 4 | 1 | 24601666 | | Mascot_Score | 21.73 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.92078 | 4 | 1 | 17317660 | -1.22192 | Mascot_Score | 58 | | plasma membrane | col-0 | continuous light | in-solution | TiO2 | trypsin | | LTQ-FT | cell culture | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 631.772 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 931.9215 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 1242.2251 | 3 | 1 | 24601666 | | Mascot_Score | 29.7 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 723.1243 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 745.7404 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGR | YEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGR | 998.9407 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |