Home Bulk Downloads Data submission Background P-Hotspots Kinome Facts & Figures Database Imprint

Modifications:

modType	position	affAmin
phos	19	S

sequence	modifiedsequence	mcr	charge	No.pSTY	PubMed	ppm	score_Type	score	age	CellCompartment	Cultivar	DayNight	DigestionProcess	Enrichment	Enzyme	GrowthChamber	Instrument	Tissue	Treatment
TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK	TDGSTTPAYAHGQHHSIF(pS)PATGAVSDSSLK	557.0289	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK	TDGSTTPAYAHGQHHSIF(pS)PATGAVSDSSLK	802.6163	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK	TDGSTTPAYAHGQHHSIF(pS)PATGAVSDSSLK	848.6773	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK	TDGSTTPAYAHGQHHSIF(pS)PATGAVSDSSLK	978.8593	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK	TDGSTTPAYAHGQHHSIF(pS)PATGAVSDSSLK	978.8582	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK	TDGSTTPAYAHGQHHSIF(pS)PATGAVSDSSLK	1135.6906	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22