| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 1215.2693 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 655.5591 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 652.3035 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 667.5649 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 802.6167 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 652.3026 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 802.616 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 838.0618 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 652.3042 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGSTTPA(pY)AHGQHHSIFSPATGAVSDSSLK | 978.8559 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |