sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
KTDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | KTDGSTTPAYAHGQHH(pS)IFSPATGAVSDSSLK | 834.64 | 4 | 1 | 19253305 | 1.0982401 | Mascot_Score | 30.6878 | 14 days | total protein | ein2 | dark | in gel | Fe-IMAC | trypsin | | QTOF | seedlings | ethylene |
KTDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | KTDGSTTPAYAHGQHH(pS)IFSPATGAVSDSSLK | 834.6392 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
KTDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | KTDGSTTPAYAHGQHH(pS)IFSPATGAVSDSSLK | 978.8598 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
KTDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | KTDGSTTPAYAHGQHH(pS)IFSPATGAVSDSSLK | 834.6385 | 4 | 1 | 23572148 | -0.179936 | Mascot_Score | 32 | 14 days | soluble fraction | srk2dei | 16h light/8h dark | in-solution | TiO2 | trypsin | | LTQ-Orbitrap | leaf | abscisic acid |
KTDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | KTDGSTTPAYAHGQHH(pS)IFSPATGAVSDSSLK | 978.8591 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |