| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| KTDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | K(pT)DGSTTPAYAHGQHHSIFSPATGAVSDSSLK | 834.6373 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| KTDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | K(pT)DGSTTPAYAHGQHHSIFSPATGAVSDSSLK | 871.4102 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |